PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002989-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 170aa    MW: 17778.8 Da    PI: 8.2081
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002989-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1535.6e-481811797
               NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                        mkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+++re+egek
  WALNUT_00002989-RA  1 MKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREMEGEK 81
                        9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.02E-32191IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.2E-43191IPR009072Histone-fold
PfamPF008085.3E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.8E-211937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.8E-213856No hitNo description
PRINTSPR006157.8E-215775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MKKALPANAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF  60
EDYVEPLKVY LQRFREMEGE KSVAVRDKDA SAGGASSTGF GNGGTFEQPG GGGGVYGSSS  120
GMGMMMHQGG HVYGSSGFHQ QIGTTGSGFG GLGKSGTGYV GPGSNTGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-381761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-381761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523242.13e-75PREDICTED: nuclear transcription factor Y subunit B-3-like
TrEMBLA0A0R0F8V11e-74A0A0R0F8V1_SOYBN; Uncharacterized protein
STRINGGLYMA18G08620.14e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-54nuclear factor Y, subunit B3